PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g12600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 314aa    MW: 35613.2 Da    PI: 8.0616
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g12600genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-18151205256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tkeq  +Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  CA06g12600 151 RKKLRLTKEQSAILEDSFKEHHTLNPKQKLALAKRLELRPRQVEVWFQNRRARTK 205
                 678899***********************************************98 PP

2HD-ZIP_I/II124.54.9e-40151239190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rl+keq+++LE+sF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+e+n+rL+kev+eLr +
   CA06g12600 151 RKKLRLTKEQSAILEDSFKEHHTLNPKQKLALAKRLELRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCVENLTEDNRRLQKEVQELR-S 239
                  69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046188.8E-312125IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.28E-18141208IPR009057Homeodomain-like
PROSITE profilePS5007116.925147207IPR001356Homeobox domain
SMARTSM003897.6E-16149211IPR001356Homeobox domain
PfamPF000464.9E-16151205IPR001356Homeobox domain
CDDcd000869.04E-15151208No hitNo description
Gene3DG3DSA:1.10.10.601.8E-17156205IPR009057Homeodomain-like
PROSITE patternPS000270182205IPR017970Homeobox, conserved site
PfamPF021831.2E-9207240IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.0E-25207250IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MMMEKEDLGL SLSLSFPTEK RTTVINPMQQ RNLIPSTIIS PYATTSTFNL IHKSAPNWST  60
QSLFPDSSSD RNSETCRLVE TRSFLKGIDV NRMPAANGDA EEEAGVSSPN STISSLSGNK  120
RSEREANCEE NEMERASSRG ISDEEDGENC RKKLRLTKEQ SAILEDSFKE HHTLNPKQKL  180
ALAKRLELRP RQVEVWFQNR RARTKLKQTE VDCEFLKRCV ENLTEDNRRL QKEVQELRSL  240
KLSPQFYMQM TPPTTLTMCP SCERVASGPT NTPVNVQVGP PHHHQPMPLN MWAPTTQGQY  300
GQMESYPTLA RQK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1199207RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-91HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016575096.10.0PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotQ054661e-101HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A0V0HY501e-167A0A0V0HY50_SOLCH; Putative homeobox-leucine zipper protein HAT4-like
STRINGPGSC0003DMT4000620811e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-99homeobox protein 2